Pcbeachfish.com

Pcbeachfish.com has Server used 216.122.144.147 IP Address with Hostname in United States. Below listing website ranking, Similar Webs, Backlinks. This domain was first 2018-04-25 (3 years, 182 days) and hosted in Atlanta United States, server ping response time 71 ms

DNS & Emails Contact

This tool is used to extract the DNS and Emails from this domain uses to contact the customer.

Fetching Emails ...

Extract All Emails from Domain

Top Keywords Suggestions

Keywords suggestion tool used Pcbeachfish keyword to suggest some keywords related from this domain. If you want more, you can press button Load more »

1 Pcbeachfishingcharters.com
2 Pc beach fishing rodeo
3 Pc beach fishing report

Hosting Provider

Website: Pcbeachfish.com
Hostname: mail.awts.com
Country:
NetName:
Address: 191 The West Mall,
Region: GA
City: Atlanta
Postal Code: 30303
Latitude: 33.748001098633
Longitude: -84.385803222656
Area Code: 404
Email Abuse1. [email protected]
2. [email protected]

Find Other Domains on Any IP/ Domain


New! Domain Extensions Updated .com .org .de .net .uk   » more ...

Domains Actived Recently

   » Revo.com (4 day ago)

   » Bobbyjonesband.com (4 day ago)

   » Huishoubao.com (2 day ago)

   » M1file.com (1 day ago)

   » Renhomesantalya.com (2 hours ago)

   » Napadrivertours.com (1 day ago)

Results For Websites Listing

Found 31 Websites with content related to this domain, It is result after search with search engine

Panama City Fishing Charters // North Bay Light Tackle

Pcbeachfish.com   DA: 15 PA: 15 MOZ Rank: 30

  • If trip must be canceled due to weather or mechanical failure, trip deposit will be refunded in full
  • Weather cancellations are at captain’s discretion
  • Trips can be canceled outside of 14 days with no charge

Inshore And Shallow Water Fishing Boats

Pcbeachfish.com   DA: 15 PA: 11 MOZ Rank: 27

  • We have offshore, inshore and shallow water boats to maximize your fishing experience
  • Our Captain, Larry Lemieux has been fishing these waters for over 25 years and will be sure you make memories with your friends and family
  • Give us a call at 850-527-6571 for more information
  • Larry’s voice mail, he's fishing and will call you back the same day.

PC Beach Fishing Rodeo

Mbasic.facebook.com   DA: 19 PA: 21 MOZ Rank: 42

  • 912 likes · 15 talking about this
  • The PC Beach Fishing Rodeo will be September 24-October 10
  • This event will be 17 amazing days …

Pcbeachfish.com (Panama City Fishing Charters // North Bay

Host.io   DA: 7 PA: 16 MOZ Rank: 26

pcbeachfish.com (hosted on aptum.com) details, including IP, backlinks, redirect information, and reverse IP shared hosting data

North-bay-light-tackle-panama-city-

Local.yahoo.com   DA: 15 PA: 50 MOZ Rank: 69

  • Larry was AMAZING! What a time!! Caught tons of amberjack and even a bull shark! Definitely going out with him and again and …

Grand Lagoon Life

Iphone.facebook.com   DA: 19 PA: 50 MOZ Rank: 74

  • Registration is cut off for all private anglers by 12 midnight next Tuesday, September 21 for the PC Beach Fishing Rodeo
  • You can either register/pay online at www.PCBeachFish ingRodeo.com, or in person at the ticket counter at Capt
  • Please help us spread the word!

North Bay Light Tackle

Facebook.com   DA: 16 PA: 21 MOZ Rank: 43

  • North Bay Light Tackle, Upper Grand Lagoon, Florida
  • 743 likes · 183 talking about this · 68 were here
  • Go light tackle fishing around inlet and Gulf on a 36' custom charter boat rated for 6 people.

17+ Pictures Of Deep Sea Fishing Boats Gif

Deepseawebsite.blogspot.com   DA: 27 PA: 50 MOZ Rank: 84

  • We do not collect any pictures off the internet to mislead you as a customer! Source: cozumelcruiseexcursions.com
  • We went deep sea fishing for the fist time and i can't say enough about how great the sea spirit and crew were
  • Source: www.vipfishingcharters.com

Art-wave.com (Art Wave Gallery

Host.io   DA: 7 PA: 13 MOZ Rank: 28

art-wave.com (hosted on aptum.com) details, including IP, backlinks, redirect information, and reverse IP shared hosting data

Offshore Fishing Panama City Beach Fl : Frequently Asked

Auliyahjamet.blogspot.com   DA: 25 PA: 50 MOZ Rank: 84

  • Offshore Fishing Panama City Beach Fl : Frequently asked questions about panama city beach.
  • ‹ › fishing at panama city beach.The turquoise profundities off our sandy regardless of the span of your gathering or dimension of involvement, panama city fl fishing charters have the correct angling contract boat for you.

Sick And Tired Of Doing Ocean Fishing Boat The Old Way

Renoophotography.blogspot.com   DA: 29 PA: 50 MOZ Rank: 89

Sick And Tired Of Doing Ocean Fishing Boat The Old Way? Read This.Ocean fishing is exclusive to fishers which allow them to set sail together on the endeavor in …

New Best Deep Sea Fishing Boats 2018 Background

Deepseawebsite.blogspot.com   DA: 27 PA: 50 MOZ Rank: 88

  • Voyager deep sea fishing is the place for a great fishing experience
  • Center consoles, sportfishing yachts and walkarounds are but first, let's make sure everyone understands that deep sea means different things to different people who partake in different fisheries

Websites With Keyword

Brandnewblogs.com   DA: 17 PA: 14 MOZ Rank: 43

  • Below is a collection of websites that have content with the king mackerel keyword
  • These website examples are randomly selected from our database, you will see different sites each time you refresh this page (if the selected keyword is not too rare, which may result in a few pages only).

CSS Loading Order Broken WordPress.org

Wordpress.org   DA: 13 PA: 40 MOZ Rank: 66

  • Morning; the problem is due to the fact that fl-automator-skin-css is loaded from wp-content/uploads which by default is excluded from autoptimization (to prevent cache size issues as CSS in wp-content/uploads might change a lot)
  • if you remove wp-content/uploads from the CSS optimization exclusion list, the file will be aggregated and the order will be preserved.

Websites With Keyword

Brandnewblogs.com   DA: 17 PA: 14 MOZ Rank: 45

  • Below is a collection of websites that have content with the sea trout keyword
  • These website examples are randomly selected from our database, you will see different sites each time you refresh this page (if the selected keyword is not too rare, which may result in a few pages only).

Panama City Charter Fishing

Plex.page   DA: 9 PA: 28 MOZ Rank: 52

  • Collected from the entire web and summarized to include only the most important parts of it
  • Can be used as content for research and analysis.

Offshore Fishing Panama City Beach Fl / We Specialize In

Safitrialeksan.blogspot.com   DA: 27 PA: 50 MOZ Rank: 93

Offshore Fishing Panama City Beach Fl / We specialize in inshore and offshore charters for the family..Fishing charters & tours in panama city beach.

Deep Sea Fishing Charter

Plex.page   DA: 9 PA: 25 MOZ Rank: 51

  • Deep Sea fishing is considered a sport where amateur or professional fishermen embark into the deepest parts of water in search of catch
  • Types of fish associated with the Deep Sea are those that live below what is called the photic zone of the ocean.

North Bay Light Tackle

Es-la.facebook.com   DA: 18 PA: 21 MOZ Rank: 57

  • North Bay Light Tackle, Upper Grand Lagoon
  • 752 Me gusta · 91 personas están hablando de esto · 68 personas estuvieron aquí
  • Go light tackle fishing around inlet and Gulf on a 36' custom charter boat

MarineWaypoints.com: Watersports/Fishing/Regional

Marinewaypoints.com   DA: 23 PA: 50 MOZ Rank: 92

Home: Categories: Watersports: Fishing: Regional - United States: Florida: Florida Fishing Charters, Guides, Lodges: Page 18: LINKS: Pages: [] 11 12 13 14 15 16 17

NS2.AWTS2.COM

Dns.coffee   DA: 10 PA: 26 MOZ Rank: 56

Name First Seen Last Seen; GARRYPOUND.COM: Dec 10, 2020: JIREHSUPPLIES.COM: Aug 14, 2013: Dec 03, 2020: DIXONRANEY.COM: Dec 06, 2013: Nov 29, 2020

Northbaycharters.com

Keyword-rank.com   DA: 20 PA: 26 MOZ Rank: 67

  • Provided by Alexa ranking, northbaycharters.com has ranked N/A in N/A and 8,787,558 on the world.northbaycharters.com reaches roughly 350 users per day and delivers about 10,508 users each month
  • The domain northbaycharters.com uses a Commercial suffix and it's server(s) are located in N/A with the IP number 185.230.63.186 and it is a .com
  • We specialize in Bodega bay fishing …

North Bay Light Tackle

Ro-ro.facebook.com   DA: 18 PA: 20 MOZ Rank: 60

  • North Bay Light Tackle, Upper Grand Lagoon, Florida
  • 782 de aprecieri · 357 discută despre asta · 74 au fost aici
  • Go light tackle fishing around inlet and Gulf on a 36' custom charter boat rated for

NS1.AWTS2.COM

Dns.coffee   DA: 10 PA: 26 MOZ Rank: 59

Name First Seen Last Seen; AKAPPLIANCEREPAIR.COM: Dec 18, 2018: Oct 02, 2021: OPENMIND-LEARNING.COM: Aug 09, 2012: Aug 13, 2021: DIXONRANEY.COM: Dec 02, 2020: Jun 19

Lighttacklefishingpanamacity.com Server IP 66.96.147.160

Autositechecker.com   DA: 23 PA: 40 MOZ Rank: 87

  • LIGHTTACKLEFISHINGPANAMACITY.COM Register Domain Names at GoDaddy.com, LLC 2 years 1 months 28 days ago, remaining 1 years 10 months 2 days left
  • Web Server used 66.96.147.160 IP Address at The Endurance International Group, Inc
  • provider in Burlington, United States.

Panama Deep Sea Fishing Charters" Keyword Found Websites

Keyword-suggest-tool.com   DA: 28 PA: 41 MOZ Rank: 94

Panama deep sea fishing charters keyword after analyzing the system lists the list of keywords related and the list of websites with related content, in addition you can see which keywords most interested customers on the this website

North Bay Light Tackle

Ne-np.facebook.com   DA: 18 PA: 20 MOZ Rank: 64

  • North Bay Light Tackle, Upper Grand Lagoon, Florida
  • ७६७ जनाले मन पराउनुभयो · १२२ जनाले यसको बारेमा कुरागर्दै छन् · ७४ हरु यहाँ थिए
  • Go light tackle fishing around inlet and Gulf on a …

North Bay Light Tackle

Hi-in.facebook.com   DA: 18 PA: 21 MOZ Rank: 66

  • North Bay Light Tackle, Upper Grand Lagoon, Florida
  • 727 पसंद · 50 इस बारे में बात कर रहे हैं · 68 यहाँ थे
  • Go light tackle fishing around inlet and Gulf

Northbaycharters.com" Keyword Found Websites Listing

Keyword-suggest-tool.com   DA: 28 PA: 29 MOZ Rank: 85

Northbaycharters.com keyword after analyzing the system lists the list of keywords related and the list of websites with related content, in addition you can see which keywords most interested customers on …

Pcbeachfish.com 1 Year, 213 Days Left

Site-stats.org   DA: 14 PA: 17 MOZ Rank: 60

  • Home.com Domains; Pcbeachfish.com ; Pcbeachfish.com has server used 216.122.144.147 (Canada) ping response time Hosted in Aptum Technologies Register Domain Names at GoDaddy.com, LLC.This domain has been created 3 years, 151 days ago, remaining 1 year, 213 days.You can check the 11 Websites and blacklist ip address on this server

Recently Analyzed Sites

Revo.com (4 day ago)

Bobbyjonesband.com (4 day ago)

Huishoubao.com (2 day ago)

M1file.com (1 day ago)

Renhomesantalya.com (2 hours ago)

Trekksoft.com (16 min ago)

Tibbo.com (3 day ago)

Eastside.com (8 seconds ago)

Tailspinbandsc.com (16 min ago)

Dungscanada.com (18 hours ago)

Jfsorange.org (4 hours ago)

Marloweslu.com (2 day ago)